PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00137730001
Common NameGSBRNA2T00137730001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 433aa    MW: 48203.6 Da    PI: 5.93
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00137730001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.3e-31234288155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr+rWtpeLHe+F++ v++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYRl
  GSBRNA2T00137730001 234 KPRMRWTPELHESFLKSVDKLEGPEKATPKAVLKLMNVEGLTIYHVKSHLQKYRL 288
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-29233289IPR009057Homeodomain-like
SuperFamilySSF466891.97E-16234289IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-24234289IPR006447Myb domain, plants
PfamPF002496.1E-8236287IPR001005SANT/Myb domain
PfamPF143792.5E-22324371IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MNRHRLVSTA QDECNKGLHQ PCSSSLSPVH NFLNLQPENR NSPFIRSHSP DSPWPKNSPQ  60
GTFSRSSTFC TNLYISSSST SESQKHLGNT LPFLPDPSTN SQPPSAVESA RSPSIFSEDM  120
SNPFDGDNTL VKDFFNLSGD ACSDGAFHDL DCSNDSYCLS DQMELQFLSD ELELAITDRS  180
ETPRLDEIYE TPLASSSNPV TGLSQTQRSL SGAMTIEAVS SHPSPGSAAA SNLKPRMRWT  240
PELHESFLKS VDKLEGPEKA TPKAVLKLMN VEGLTIYHVK SHLQKYRLAK HIPEKKEERK  300
SVNTEGKKLA LSNGEAGERK KGAMQLTEAL RMQMEVQKQL HEQLEVQRVL QLRIEEHAKY  360
LEKMLEEQRK TGMLMSSSSS QTSDCQNMSK TEVSSLSQPK NIASETEDDK CESPQKRRKV  420
ENNTESEDPP ER*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.229981e-31leaf| root| vegetative meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00137730001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013686413.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLA0A078D0C20.0A0A078D0C2_BRANA; BnaA03g32590D protein
STRINGAT3G13040.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.3__1373__AT3G13040.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]